PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo19G0001100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MIKC_MADS
Protein Properties Length: 188aa    MW: 21550.8 Da    PI: 10.1711
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo19G0001100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF101.23.8e-32958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng++KKA+ELSvLCdaeva+i+fs++gklyey+
  Spipo19G0001100  9 KRIENTTNRQVTFCKRRNGLFKKAYELSVLCDAEVALIVFSTRGKLYEYA 58
                     79***********************************************8 PP

2K-box57.17.9e-2075160789
            K-box   7 ks..leeakaeslqqelakLkkeienLqreqR.hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                      +s  + e +ae +q+e++ L+++i nLq ++R + lGed++  + k L++Le+ Le+++kkiR++K+  l +  + l+ +  ++ e
  Spipo19G0001100  75 TSgpVVEVNAEFYQKESDSLRRQIVNLQGKIRwNCLGEDVNHVESKKLKNLEKSLEEGIKKIRARKEMELQNDNKCLRARVSKIIE 160
                      334588899*******************888879***************************************9999999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.4E-43160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.964161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-34278IPR002100Transcription factor, MADS-box
CDDcd002657.59E-44276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-333859IPR002100Transcription factor, MADS-box
PfamPF014866.8E-1384158IPR002487Transcription factor, K-box
PROSITE profilePS512979.17884184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLFK KAYELSVLCD AEVALIVFST RGKLYEYANR  60
SVKATIERYK KACSTSGPVV EVNAEFYQKE SDSLRRQIVN LQGKIRWNCL GEDVNHVESK  120
KLKNLEKSLE EGIKKIRARK EMELQNDNKC LRARVSKIIE SERAPQLLQP PYEGFPQLDS  180
RNLLQGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008791901.11e-72PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_012572595.11e-72PREDICTED: floral homeotic protein AGAMOUS isoform X6
SwissprotQ408851e-71AG_PETHY; Floral homeotic protein AGAMOUS
TrEMBLB2CDE26e-76B2CDE2_9ASPA; Agamous MADS-box transcription factor
STRINGGSMUA_Achr10P14160_0016e-69(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.27e-62MIKC_MADS family protein